PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA33521
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NAC
Protein Properties Length: 515aa    MW: 57810.8 Da    PI: 7.408
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA33521genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.51.3e-531743011128
                        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                                lppGfrFhPtdeelvv+yLk+k+++ +l++  +i+e+d+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWk
  Tp57577_TGAC_v2_mRNA33521 174 LPPGFRFHPTDEELVVHYLKRKAASAPLPV-AIIAEIDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWK 256
                                79****************************.88***************8888999***************************** PP

                        NAM  85 atgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                atg+dk++l++ ++++vg+kk Lvfy g+ pkg+kt+W+mheyrl
  Tp57577_TGAC_v2_mRNA33521 257 ATGTDKPILTSdGNQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL 301
                                *********9967788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-63169311IPR003441NAC domain
PROSITE profilePS5100561.187174351IPR003441NAC domain
PfamPF023654.8E-28175301IPR003441NAC domain
SuperFamilySSF1019413.01E-63339351IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MELEEIEEGL GEEEKIEKKR KQGKKKERKQ GMEDGKGSAN ASNFFQTLSV SLLYAFVSQS  60
IGQSISAVLV NNPKLVVTAG SFKDDDIYSC GENVTCLVGN YPTIKHIGLD KQAKLECTAL  120
DSCVFNQALT NMDLSFPHFA HYCLPLRKFD QFIIKISSIM DSTDSSSCSQ HPHLPPGFRF  180
HPTDEELVVH YLKRKAASAP LPVAIIAEID LYKFDPWELP SKATFGEQEW YFFSPRDRKY  240
PNGARPNRAA TSGYWKATGT DKPILTSDGN QKVGVKKALV FYGGKPPKGV KTNWIMHEYR  300
LITDHNNISN NHHSYNASSK TPLLPSDHPP NNNKKNSLRL DDWVLCRIYK KSNSSTMPRP  360
PLMDQYDKEL SMEHTYNMQQ NSKPLPCSRS TSYGLENDDN FFDGILATDQ VMQNGCEINS  420
NKVDHNNESF PMKRALNVSS SQFWNETGSP GSSSSSKRFH GDLNNSGNNN IQENNSFVSL  480
LSQLPPNTTF HQNSILGDAG VMRQQFQLPD INWN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-7217435520172NAC domain-containing protein 19
3swm_B3e-7217435520172NAC domain-containing protein 19
3swm_C3e-7217435520172NAC domain-containing protein 19
3swm_D3e-7217435520172NAC domain-containing protein 19
3swp_A3e-7217435520172NAC domain-containing protein 19
3swp_B3e-7217435520172NAC domain-containing protein 19
3swp_C3e-7217435520172NAC domain-containing protein 19
3swp_D3e-7217435520172NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013457094.10.0NAC transcription factor-like protein
SwissprotQ8GY421e-108NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A072UZ300.0A0A072UZ30_MEDTR; NAC transcription factor-like protein
STRINGGLYMA07G31220.11e-167(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-103NAC domain containing protein 25